PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00951.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 448aa    MW: 50308.4 Da    PI: 5.1717
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00951.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.3e-50261761128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k........................kvkaeekewyfF 61 
                              l+pGfrFhPtdeelv++yLk+kv gk++++ ++i evdiyk+ePwdL  +                        +++++++ewyf+
  Rsa1.0_00951.1_g00019.1  26 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGEVDIYKHEPWDLAgQevllllrvsqyisgliffslsvfsRLRTRDQEWYFY 110
                              579************************999.99**************85489****************9999988888999***** PP

                      NAM  62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              s  dkky +g r nrat++gyWkatgkd+ev + + +  g+kktLvf++grap+g +t+Wvmheyrl
  Rsa1.0_00951.1_g00019.1 111 SALDKKYGNGARMNRATNKGYWKATGKDREVRR-DVQILGMKKTLVFHSGRAPDGLRTNWVMHEYRL 176
                              ********************************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5519201IPR003441NAC domain
PROSITE profilePS5100554.50726200IPR003441NAC domain
PfamPF023651.8E-2628176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGRESVVAVV SSPATAPSTV VAATALAPGF RFHPTDEELV SYYLKRKVLG KPVRFDAIGE  60
VDIYKHEPWD LAGQEVLLLL RVSQYISGLI FFSLSVFSRL RTRDQEWYFY SALDKKYGNG  120
ARMNRATNKG YWKATGKDRE VRRDVQILGM KKTLVFHSGR APDGLRTNWV MHEYRLVDYE  180
TESNGNLVQD AYVLCRIFHK NNIGPPSGNR YAPFMEEEWA DDGVALIPGV DVSVRAEPIP  240
LANGNSQSAS KDIININEPP RETTTTPMDI EVNHKDNNNN HCDDEDEEEA LKREEAGEED  300
EHPPPPSLCI LNKEAPLPLL QYKRRRQNES TRTTTTQDHS SSTITTVDNT PTTTAAAATN  360
TAISALLEFS LMGLSDKKDS QPQPLTPLAS SEEKLNDLQK EIHQMSVERE TFKLEMMSAE  420
AMISILQSRI DALRQENDEL KKNSANGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-442520219170NAC domain-containing protein 19
3swm_B4e-442520219170NAC domain-containing protein 19
3swm_C4e-442520219170NAC domain-containing protein 19
3swm_D4e-442520219170NAC domain-containing protein 19
3swp_A4e-442520219170NAC domain-containing protein 19
3swp_B4e-442520219170NAC domain-containing protein 19
3swp_C4e-442520219170NAC domain-containing protein 19
3swp_D4e-442520219170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667530.0KC966753.1 Brassica napus NAC transcription factor 51 (NAC51.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591746.10.0PREDICTED: NAC domain-containing protein 37-like
TrEMBLA0A0D3AEQ20.0A0A0D3AEQ2_BRAOL; Uncharacterized protein
STRINGBra034118.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52